Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard

Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard

Imprimir Imprimir
Por favor conéctese

Referencia PH311998

embalaje : 10ug

Contact local distributor :


Teléfono :

Oct4 (POU5F1) (NM_002701) Human Mass Spec Standard

Be the first to review this product
SKU
PH311998
POU5F1 MS Standard C13 and N15-labeled recombinant protein (NP_002692)
 

Other products for "Oct4 or NM_002701"

Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC211998
Predicted MW 38.4 kDa
Protein Sequence
Protein Sequence
>RC211998 representing NM_002701
Red=Cloning site Green=Tags(s)

MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC
GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK
ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE
ADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN
RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV
TTLGSPMHSN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002692
RefSeq Size 1417
RefSeq ORF 1080
Synonyms Oct-3; Oct-4; OCT3; OCT4; OTF-3; OTF3; OTF4
Locus ID 5460
UniProt ID Q01860
Cytogenetics 6p21.33
Summary This gene encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression of this gene in adult tissues is associated with tumorigenesis. This gene can participate in a translocation with the Ewing's sarcoma gene on chromosome 21, which also leads to tumor formation. Alternative splicing, as well as usage of alternative AUG and non-AUG translation initiation codons, results in multiple isoforms. One of the AUG start codons is polymorphic in human populations. Related pseudogenes have been identified on chromosomes 1, 3, 8, 10, and 12. provided by RefSeq, Oct 2013
Protein Families Adult stem cells, Cancer stem cells, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Transcription Factors
FAQs
  • Protein FAQs
SDS
SKU Description Size
LC400950 Lyophilized POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC404373 Lyophilized POU5F1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400950 Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 1 (as WB positive control) 100 ug
LY404373 Transient overexpression lysate of POU class 5 homeobox 1 (POU5F1), transcript variant 2 (as WB positive control) 100 ug
TP311998 Recombinant protein of human POU class 5 homeobox 1 (POU5F1), transcript variant 1, 20 µg 20 ug
TP760938 Purified recombinant protein of Human POU class 5 homeobox 1 (POU5F1/OCT4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.