NPAS3 Antibody - middle region - FITC
Referencia ARP39935_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
NPAS3 Antibody - middle region : FITC (ARP39935_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-NPAS3 (ARP39935_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human NPAS3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: CESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NPAS3 (ARP39935_P050-FITC) antibody is Catalog # AAP39935 |
| Gene Symbol | NPAS3 |
|---|---|
| Gene Full Name | neuronal PAS domain protein 3 |
| Alias Symbols | MOP6, PASD6, bHLHe12 |
| NCBI Gene Id | 64067 |
| Protein Name | Neuronal PAS domain-containing protein 3 |
| Description of Target | This gene encodes a member of the basic helix-loop-helix and PAS domain-containing family of transcription factors. The encoded protein is localized to the nucleus and may regulate genes involved in neurogenesis. Chromosomal abnormalities that affect the coding potential of this gene are associated with schizophrenia and mental retardation. Alternate splicing results in multiple transcript variants. |
| Uniprot ID | Q8IXF0-6 |
| Protein Accession # | NP_001158221 |
| Nucleotide Accession # | NM_001164749 |
| Protein Size (# AA) | 257 |
| Molecular Weight | 28kDa |
| Protein Interactions | ARNT2; |
