NANOG, N-His, recombinant protein

Referencia NB-21-25989

embalaje : 100ug

Marca : Neo Biotech

Contact local distributor :


Teléfono : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9H9S0
Molecular weight:
19.83 kDa
His Trp153–Val305

Specifications NANOG, N-His, recombinant protein

Product name NANOG, N-His, recombinant protein
Uniprot ID Q9H9S0
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence WQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV
Molecular weight 19.83 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Trp153-Val305
Protein Accession Q9H9S0
Reference PX-P5853
Note For research use only
Molecular Constructor
His Trp153–Val305

Documents

3D Representation

NANOG, N-His, recombinant protein

Reviews

There are no reviews yet.

Be the first to review “NANOG, N-His, recombinant protein” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody