ME3 Antibody - N-terminal region - Biotin
Referencia ARP48511_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ME3 Antibody - N-terminal region : Biotin (ARP48511_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ME3 (ARP48511_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ME3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ME3 (ARP48511_P050-Biotin) antibody is Catalog # AAP48511 (Previous Catalog # AAPY01455) |
| Reference | Loeber,G., Biochem. J. 304 (PT 3), 687-692 (1994) |
|---|---|
| Gene Symbol | ME3 |
| Gene Full Name | Malic enzyme 3, NADP(+)-dependent, mitochondrial |
| Alias Symbols | NADP-ME |
| NCBI Gene Id | 10873 |
| Protein Name | NADP-dependent malic enzyme, mitochondrial |
| Description of Target | Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. ME3 is a mitochondrial NADP(+)-dependent isoform. Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. |
| Uniprot ID | Q16798 |
| Protein Accession # | NP_001014811 |
| Nucleotide Accession # | NM_001014811 |
| Protein Size (# AA) | 604 |
| Molecular Weight | 67kDa |
| Protein Interactions | UBC; TRAF4; |
