Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> LL-37, human [154947-66-7]

LL-37, human [154947-66-7]

Imprimir Imprimir
Por favor conéctese

Referencia HY-P1222-1mg

embalaje : 1mg

Marca : MedChemExpress

Contact local distributor :


Teléfono : +1 850 650 7790

Descripciòn

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing[1][2][3].

Cellular Effect
Cell Line Type Value Description References
MRC5 IC50
64 μM
Compound: LL-37
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
[PMID: 34342438]
In Vitro

LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration[2].
LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].
LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

LL-37, human Related Antibodies

Cell Migration Assay [2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 1, 2.5, 5, 10 and 20 μg/mL
Incubation Time: 24 hours
Result: Dose-dependently stimulated HCEC migration but showed no effect on cell proliferation.

Cell Viability Assay[2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
Incubation Time: 6 and 24 hours
Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
In Vivo

LL-37, human (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
Administration: Intratracheal injection; 0.4-2.0 mg/kg once
Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
Peso molecular

4493.26

Fòrmula

C205H340N60O53
No. CAS
Appearance

Solid

Color

White to off-white

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Sequence Shortening

[LL-37, 37 aa]
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvente y solubilidad
In Vitro: 

H2O : 50 mg/mL (11.13 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2226 mL 1.1128 mL 2.2256 mL
5 mM 0.0445 mL 0.2226 mL 0.4451 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculadora de molaridad

  • Calculadora de dilución

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureza y Documentación
Referencias

Usted podría estar interesado también en los siguientes productos:



Referencia
Descripción
Cond.
Precio Sin IVA
228-11059-2
Lysostaphin Recombinant
 5mg 
228-11059-3
Lysostaphin Recombinant
 10mg 
HY-B0108-50mg
Daptomycin [103060-53-3]
 50mg