Insulin glargine [160337-95-1]
Referencia NB-64-79246-50mg
embalaje : 50mg
Marca : Neo Biotech
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1]. |
| Molecular Weight | 6062.89 |
| Formula | C267H404N72O78S6 |
| Cas No. | 160337-95-1 |
| Sequence | A-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19) |
| Sequence Short | A-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19) |
| Storage | Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |


