Insulin glargine [160337-95-1]

Referencia NB-64-79246-5mg

embalaje : 5mg

Marca : Neo Biotech

Contact local distributor :


Teléfono : +1 850 650 7790

Insulin glargine

Catalog No. T73688 Copy Product Info
Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1].

Insulin glargine

Copy Product Info

Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1].

TargetMol | Customer service

Product Introduction

Bioactivity
Description
Insulin glargine, a long-acting insulin analog, is utilized for the treatment of diabetes mellitus [1].
Chemical Properties
Molecular Weight6062.89
FormulaC267H404N72O78S6
Cas No.160337-95-1
SequenceA-chain: Gly-Ile-Val-Glu-Gln-Cys-Cys-Thr-Ser-Ile-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Gly; B-chain: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr-Arg-Arg (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
Sequence ShortA-chain: GIVEQCCTSICSLYQLENYCG; B-chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR (Disulfide bridge: CysA6-CysA11, CysA7-CysB7, CysA20-CysB19)
Storage & Solubility Information
StoragePowder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.