IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (FITC)
Referencia 128469-FITC-100ul
embalaje : 100ul
Marca : US Biological
128469-FITC IL4 (Interleukin-4, IL-4, B Cell Stimulatory Factor 1, BSF-1, Binetrakin, Lymphocyte Stimulatory Factor 1, Pitrakinra, MGC79402) (FITC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG2a,kGrade
Affinity PurifiedApplications
FLISACrossreactivity
HuAccession #
NM_000589, NP_000580Shipping Temp
Blue IceStorage Temp
-20°CIL-4 is a potent lymphoid cell growth factor that stimulates the growth and survivability of certain B cells and T cells. Human IL-4 is a 15kD globular protein containing 130aa residues.
Applications:
Suitable for use in FLISA. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Storage and Stability:
Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.

