Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag

Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag

Imprimir Imprimir
Por favor conéctese

Referencia 584877-20ug

embalaje : 20ug

Marca : US Biological

Contact local distributor :


Teléfono : +1 850 650 7790

584877 Holo-[acyl-carrier-protein] Synthase, Recombinant, Acholeplasma laidlawii, aa1-118, His-Tag, Myc-Tag

Swiss Prot
A9NHV3
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Source:
Recombinant protein corresponding to aa1-118 from Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli.

Molecular Weight:
~20.9kD

Amino Acid Sequence:
MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)