HMGCS2 Antibody - N-terminal region - FITC
Referencia ARP41562_T100-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
HMGCS2 Antibody - N-terminal region : FITC (ARP41562_T100-FITC)
| Datasheets/Manuals | Printable datasheet for anti-HMGCS2 (ARP41562_T100-FITC) antibody |
|---|
| Publications | Karimian Azari, E., Leitner, C., Jaggi, T., Langhans, W. & Mansouri, A. Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR--alpha agonist Wy-14643 in high-fat diet fed rats. PLoS One 8, e74869 (2013). Chip-Seq, ChIP, Dog, Horse, Rabbit, Rat, Guinea pig, Human, Mouse, Goat, Bovine 24069361 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2 |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HMGCS2 (ARP41562_T100-FITC) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247) |
| Reference | Bouchard,L., (2001) Pediatr. Res. 49 (3), 326-331 |
|---|---|
| Gene Symbol | HMGCS2 |
| Gene Full Name | 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) |
| NCBI Gene Id | 3158 |
| Protein Name | Hydroxymethylglutaryl-CoA synthase, mitochondrial |
| Description of Target | HMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase. |
| Uniprot ID | P54868 |
| Protein Accession # | NP_005509 |
| Nucleotide Accession # | NM_005518 |
| Protein Size (# AA) | 508 |
| Molecular Weight | 56kDa |
| Protein Interactions | UBC; APP; YWHAQ; |
