Quimigen Portugal > HMGB1 Protein
HMGB1 Protein
Marca : Aviva Systems Biology
| Datasheets/Manuals | Printable datasheet for HMGB1 Protein (OPPA01571) |
|---|
| Predicted Species Reactivity | Human |
|---|---|
| Product Format | Lyophilized from a 0.2 um filtered concentrated solution in PBS (pH 7.4) |
| Host | E. Coli |
| Reconstitution and Storage | It is recommended to reconstitute the lyophilized HMGB1 in sterile 18M-omega-cm H2O not less than 100 ug/mL, which can then be further diluted to other aqueous solutions. Lyophilized HMGB1, although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long-term storage, it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze/thaw cycles. |
| Purification | The HMGB-1 is purified by proprietary chromatographic techniques. |
| Purity | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Peptide Sequence | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH. |
| Tag | 6xHis tag |
| Gene Symbol | HMGB1 |
|---|---|
| Alias Symbols | HMG1, HMG3, HMG-1, SBP-1 |
| NCBI Gene Id | 3146 |
| Protein Name | High mobility group protein B1 |
| Description of Target | HMG1 Human Recombinant fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids. |
| Uniprot ID | P09429 |
| Protein Accession # | NP_002119.1 |
| Protein Size (# AA) | Recombinant |
| Molecular Weight | 26 kDa |
Protein interactions
| Name | # of Products |
|---|---|
| AES | 70 |
| AGER | 20 |
| AR | 434 |
| ATOH1 | 8 |
| C14orf1 | 153 |
| CASP3 | 324 |
| Ccdc15 | 38 |
| CDK1 | 487 |
| CREBBP | 802 |
| CRMP1 | 164 |
| CSNK1A1 | 104 |
| CTCF | 81 |
| DNM2 | 91 |
| ERF | 13 |
| FCP1 | 24 |
| FOXA3 | 17 |
| FOXC1 | 7 |
| H3F3A | 189 |
| HMGB2 | 25 |
| HNRNPK | 104 |
| HR | 23 |
| HSPA8 | 331 |
| LRIF1 | 281 |
| ME | 21 |
| MNT | 24 |
| NCAN | 30 |
| NEUROD6 | 7 |
| PDIA3 | 61 |
| POU5F1 | 224 |
| PPP2R3A | 22 |
| PRKDC | 226 |
| RASSF4 | 8 |
| RFX1 | 20 |
| SIX5 | 8 |
| SOX18 | 12 |
| TAF1 | 88 |
| TBP | 255 |
| TFE3 | 45 |
| TGIF1 | 46 |
| TLE1 | 178 |
| TLE2 | 49 |
| TLR2 | 123 |
| TLR4 | 158 |
| TP73 | 137 |
| UNC119 | 185 |
Biological process
| Name | # of Products |
|---|---|
| Apoptotic process | 586 |
| Base-excision repair, DNA ligation | 2 |
| Cellular component disassembly involved in apoptosis | 43 |
| Dendritic cell chemotaxis | 15 |
| DNA fragmentation involved in apoptotic nuclear change | 33 |
| DNA ligation involved in DNA repair | 8 |
| DNA recombination | 76 |
| DNA topological change | 6 |
| Eye development | 24 |
| Inflammatory response to antigenic stimulus | 8 |
| Innate immune response | 300 |
| Lung development | 105 |
| Myeloid dendritic cell activation | 1 |
| Negative regulation of apoptotic cell clearance | 1 |
| Negative regulation of RNA polymerase II transcriptional preinitiation complex assembly | 3 |
| Negative regulation of transcription from RNA polymerase II promoter | 574 |
| Neuron projection development | 72 |
| Positive chemotaxis | 33 |
| Positive regulation of apoptotic process | 239 |
| Positive regulation of catalytic activity | 55 |
| Positive regulation of cysteine-type endopeptidase activity involved in apoptotic process | 36 |
| Positive regulation of DNA binding | 27 |
| Positive regulation of glycogen catabolic process | 4 |
| Positive regulation of myeloid cell differentiation | 7 |
| Positive regulation of transcription from RNA polymerase II promoter | 968 |
| Regulation of transcription from RNA polymerase II promoter | 308 |
| Response to glucocorticoid stimulus | 109 |
| V(D)J recombination | 9 |
Cellular components
| Name | # of Products |
|---|---|
| Cell surface | 369 |
| Condensed chromosome | 21 |
| Cytoplasm | 4549 |
| Extracellular region | 1573 |
| Extracellular space | 884 |
| Neuron projection | 94 |
| Nucleolus | 1179 |
| Nucleoplasm | 775 |
| Nucleus | 4914 |
| Soluble fraction | 338 |
| Transcriptional repressor complex | 43 |
Protein function
| Name | # of Products |
|---|---|
| Calcium-dependent protein kinase regulator activity | 7 |
| Chemoattractant activity | 120 |
| Cytokine activity | 1104 |
| Damaged DNA binding | 135 |
| DNA binding | 3958 |
| DNA binding, bending | 220 |
| Double-stranded DNA binding | 533 |
| Protein binding | 12191 |
| Protein kinase activator activity | 51 |
| RAGE receptor binding | 22 |
| Repressing transcription factor binding | 106 |
| Sequence-specific DNA binding transcription factor activity | 2776 |
| Single-stranded DNA binding | 136 |
| Transcription factor binding | 934 |
-
HMGB1 Antibody - N-terminal region (ARP38109_P050)Catalog #: ARP38109_P050Species Tested: Human, RatApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. -
HMGB1 Antibody (Acetyl-Lys12) (OASG03545)Catalog #: OASG03545Application: ELISA, IF, IHC, IPFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. -
HMGB1 ELISA Kit (Mouse) : 96 Wells (OKEH00424)Catalog #: OKEH00424Kit Range: 0.156 - 10ng/mLSensitivity: 0.082 ng/mLSize: 96 Wells -
HMGB1 ELISA Kit (Chicken) (OKEH03961)Catalog #: OKEH03961Application: ELISA-SandwichKit Range: 0.156-10ng/mLSensitivity: 0.062 ng/mL -
HMGB1 ELISA Kit (Mouse) (OKCD04072)Catalog #: OKCD04072Application: ELISA-SandwichKit Range: 46.88-3,000pg/mLSensitivity: 18.29 pg/mL


