OPCA03262-100UG | HA Recombinant Protein Quimigen Portugal

Datasheets/Manuals	Printable datasheet for HA Recombinant Protein (Influenza A virus) (OPCA03262)

Product Info
Predicted Species Reactivity	Influenza A Virus
Product Format	Liquid or Lyophilized powder
Reconstitution and Storage	-20°C or -80°C
Peptide Sequence	GIFGAIAGFIENGWEGMSSGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVVLLGFIMVSCQKGNIRCNICI
Source	Yeast

Protein Name	Hemagglutinin
Description of Target	Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.
Uniprot ID	P03441
Protein Size (# AA)	Partial
Molecular Weight	27.3 kDa

HA Recombinant Protein