GSTM1 Antibody - N-terminal region - FITC
Referencia ARP41769_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
GSTM1 Antibody - N-terminal region : FITC (ARP41769_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-GSTM1 (ARP41769_P050-FITC) antibody |
|---|
| Publications | Bates, D. J. et al. MicroRNA regulation in Ames dwarf mouse liver may contribute to delayed aging. Aging Cell 9, 1-18 (2010). WB, ICC/IF, IP, Bovine, Mouse, Human, Rat, Dog, Horse, Rabbit, Guinea pig, Goat, Sheep 19878148 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GSTM1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GSTM1 (ARP41769_P050-FITC) antibody is Catalog # AAP41769 (Previous Catalog # AAPP10817) |
| Reference | Sobti,R.C., (2006) Cancer Genet. Cytogenet. 166 (2), 117-123 |
|---|---|
| Gene Symbol | GSTM1 |
| Gene Full Name | Glutathione S-transferase mu 1 |
| Alias Symbols | MU, H-B, GST1, GTH4, GTM1, MU-1, GSTM1-1, GSTM1a-1a, GSTM1b-1b |
| NCBI Gene Id | 2944 |
| Protein Name | Glutathione S-transferase Mu 5 |
| Description of Target | Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene. |
| Uniprot ID | P46439 |
| Protein Accession # | NP_000552 |
| Nucleotide Accession # | NM_000561 |
| Protein Size (# AA) | 218 |
| Molecular Weight | 26kDa |
| Protein Interactions | GSTM3; UBC; IQCB1; MAP3K5; GSTM2; GSTM1; |






