Glucagon-Like Peptide 1 (7-37)
Referencia E-PP-1222-5mg
embalaje : 5mg
Marca : Elabscience
Contact local distributor :
Teléfono : +1 850 650 7790
For research use only.
| Sequence (One Letter Code) | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Sequence (Three Letter Code) | His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly |
| Calculated Molecular Weight | 3337.73 |
| Molecular Formula | C151H226N40O46 |
| Form | Lyophilized powder |
| Purity | > 95% |
| Storage | -20℃ |
| Shipping | ice bag |
| Note | For research use only. |
-
IF：{{item.impact}}
Journal：{{item.journal}} ({{item.year}})
DOI：{{item.doi}}Reactivity：{{item.species}}
Sample Type：{{item.sample_type}}
-
Q{{(FAQpage.currentPage - 1)*pageSize+index+1}}:{{item.name}}
No files available. Please enter the correct identification code in the search area to query the relevant documents.
| Title | Status | Valid until | Action | |
|---|---|---|---|---|
| {{v.文件名}} | {{v.status_str}} | {{v.timestamp_str}} | Download | / |
*Note：Please download the relevant files within the validity period. After expiration, file preview and download will not be available on the page.
Contact with Us
Toll-free: 1-888-852-8623
Tel: 1-832-243-6086
Add: 14780 Memorial Drive, Suite 105,
Houston, Texas, 77079, USA
Houston, Texas, 77079, USA
