Reactivos e instrumentos para inmunología, biología celular y biología molecular.
Identifícate
¿Olvidaste tu contraseña?
Abrir una cuenta
pt en es
0
0
Ver mi carrito
  • Catálogo
  • Áreas de investigación
  • Diagnóstico
  • Servicios
  • Recursos técnicos
  • Promociones
  • Contacto
Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
Quimigen Portugal > FGG monoclonal antibody (MP01), clone 1F2 (PE)

FGG monoclonal antibody (MP01), clone 1F2 (PE)

Imprimir Imprimir
Por favor conéctese

Referencia H00002266-MP01-50ug

embalaje : 50ug

Contact local distributor :


Teléfono : +1 850 650 7790

Marca : Abnova

Solicitar más información

Contact local distributor :


Teléfono : +1 850 650 7790

View product citations for antibody H00002266-MP01 on CiteAb
  • Specifications

    Product Description

    PE conjugated mouse monoclonal antibody raised against a partial recombinant FGG.small size,trial size,MAB,monoclonal Ab,monoclonal antibody

    Immunogen

    FGG (AAH07044, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (73); Rat (71)

    Conjugation

    PE

    Isotype

    IgG1 kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at 4°C.

  • Applications

    Flow Cytometry

    Immunofluorescence

    Protocol Download

    Western Blot

  • Gene Info — FGG

    Entrez GeneID

    2266

    GeneBank Accession#

    BC007044

    Protein Accession#

    AAH07044

    Gene Name

    FGG

    Gene Alias

    -

    Gene Description

    fibrinogen gamma chain

    Omim ID

    134850

    Gene Ontology

    Hyperlink

    Gene Summary

    The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

    Other Designations

    fibrinogen, gamma chain|fibrinogen, gamma polypeptide

  • Interactomes
    • FGG
  • Pathways
    • Complement and coagulation cascades
  • Diseases
    • Alzheimer disease
    • Aortic Diseases
    • Atherosclerosis
    • Brain Ischemia
    • Calcinosis
    • Cardiovascular Diseases
    • Carotid Artery Diseases
    • Carotid Stenosis
    • Cerebral Hemorrhage
    • Coronary Artery Disease
    • Coronary Disease
    • Diabetes Complications
    • Diabetes Mellitus
    • Edema
    • Genetic Predisposition to Disease
    • Hemophilia A
    • Hypertension
    • Inflammation
    • Ischemia
    • Ischemic Attack
    • Kidney Failure
    • Lymphoma
    • Macular Degeneration
    • Metabolic Syndrome X
    • Myocardial Infarction
    • Neoplasms
    • Osteoporosis
    • Stroke
    • Thromboembolism
    • Thrombosis
    • Vascular Diseases
    • Venous Thrombosis

    + View More Disease

    - View Less Disease

eProcurement
This product can not be ordered from your electronic catalog. A quotation will be created for this reference, would you like to continue? In this case, make sure that you have filled in the desired quantity
 


Rua Almada Negreiros Lote 5, Loja 14
2615-275 Alverca do Ribatejo - Portugal
Teléfono: +351 30 8808 050
(Chamada para a rede fixa nacional)
Fax: +351 30 8808 052
(Chamada para a rede fixa nacional)
Correo electrónico: info@quimigen.pt

otra información

¿Cómo realizar un pedido?
Condiciones de Venta
Bolsa de trabajo
¿Quiénes somos?
Boletín de noticias
Políticas de calidad
Eventos
Aviso legal

Todas las marcas comerciales o marcas registradas que aparecen en este sitio son propiedad de sus respectivos dueños
In
pt en es