Ehf Antibody - N-terminal region - Biotin
Referencia ARP40136_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Ehf Antibody - N-terminal region : Biotin (ARP40136_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-Ehf (ARP40136_P050-Biotin) antibody |
|---|
| Publications | He, J. et al. Profile of Ets gene expression in human breast carcinoma. Cancer Biol. Ther. 6, 76-82 (2007). WB, Mouse, Rat, Human, Pig, Horse, Rabbit, Guinea pig, Sheep, Dog, Bovine 17172821 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse Ehf |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Ehf (ARP40136_P050-Biotin) antibody is Catalog # AAP40136 (Previous Catalog # AAPP23345) |
| Reference | Ko,M.S., (2000) Development 127 (8), 1737-1749 |
|---|---|
| Gene Symbol | Ehf |
| Gene Full Name | Ets homologous factor |
| Alias Symbols | AU019492, 9030625L19Rik |
| NCBI Gene Id | 13661 |
| Protein Name | ETS homologous factor |
| Description of Target | Ehf is a transcriptional activator that may play a role in regulating epithelial cell differentiation and proliferation. It may act as a repressor for a specific subset of ETS/AP-1-responsive genes, and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. It binds to DNA sequences containing the consensus nucleotide core sequence GGAA and involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter |
| Uniprot ID | Q9NZC4 |
| Protein Accession # | NP_031940 |
| Nucleotide Accession # | NM_007914 |
| Protein Size (# AA) | 300 |
| Molecular Weight | 33kDa |
| Protein Interactions | Nfkbiz; |
