DCN Antibody - N-terminal region - FITC
Referencia ARP48199_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
DCN Antibody - N-terminal region : FITC (ARP48199_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-DCN (ARP48199_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Additional Information | IHC Information: Paraffin embedded skin tissue, tested with an antibody dilution of 2.5 ug/ml. |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DCN |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 100%; Goat: 92%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 86%; Sheep: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: IGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGLDKVPKDLPPDTTL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DCN (ARP48199_P050-FITC) antibody is Catalog # AAP48199 (Previous Catalog # AAPS22710) |
| Reference | Nakatani,T., Mol. Cell. Biochem. 308 (1-2), 201-207 (2008) |
|---|---|
| Gene Symbol | DCN |
| Gene Full Name | Decorin |
| Alias Symbols | CSCD, PG40, PGII, PGS2, DSPG2, SLRR1B |
| NCBI Gene Id | 1634 |
| Protein Name | Decorin |
| Description of Target | DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. This protein and biglycan are thought to be the result of a gene duplication. DCN is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome. |
| Uniprot ID | P07585 |
| Protein Accession # | NP_001911 |
| Nucleotide Accession # | NM_001920 |
| Protein Size (# AA) | 359 |
| Molecular Weight | 36kDa |
| Protein Interactions | BRCA1; MET; WISP1; COL4A6; COL4A5; FLNA; TNF; TGFB1; THBS1; MMP3; MMP7; SFTPD; PLA2G2A; AHSG; FN1; FBN1; EGFR; ELN; DPT; C1QA; MMP2; COL14A1; COL5A1; COL1A2; COL1A1; COL4A4; COL4A1; COL4A3; TGFB2; COL6A1; |
