DAZ4 Antibody - N-terminal region - FITC
Referencia ARP40243_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
DAZ4 Antibody - N-terminal region : FITC (ARP40243_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-DAZ4 (ARP40243_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DAZ4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-DAZ4 (ARP40243_P050-FITC) antibody is Catalog # AAP40243 (Previous Catalog # AAPP22087) |
| Reference | Fernandes S, (2003) Am J Hum Genet. 2004 Jan;74(1):180-7. |
|---|---|
| Gene Symbol | DAZ4 |
| Gene Full Name | Deleted in azoospermia 4 |
| Alias Symbols | pDP1680, pDP1681 |
| NCBI Gene Id | 57135 |
| Protein Name | Deleted in azoospermia protein 4 |
| Description of Target | This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis. |
| Uniprot ID | Q86SG3 |
| Protein Accession # | AAF91331 |
| Nucleotide Accession # | NM_001005375 |
| Protein Size (# AA) | 331 |
| Molecular Weight | 36kDa |
| Protein Interactions | UBC; DZIP1; PUM2; DAZL; BOLL; QKI; |
