CYP4F12 antibody - C-terminal region
Referencia ARP49789_P050
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
CYP4F12 Antibody - C-terminal region (ARP49789_P050)
| Datasheets/Manuals | Printable datasheet for anti-CYP4F12 (ARP49789_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP4F12 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 93%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: TVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CYP4F12 (ARP49789_P050) antibody is Catalog # AAP49789 (Previous Catalog # AAPP29361) |
| Reference | Dhar,M., (2008) J. Lipid Res. 49 (3), 612-624 |
|---|---|
| Gene Symbol | CYP4F12 |
| Gene Full Name | Cytochrome P450, family 4, subfamily F, polypeptide 12 |
| Alias Symbols | CYPIVF12, F22329_1 |
| NCBI Gene Id | 66002 |
| Protein Name | Cytochrome P450 4F12 |
| Description of Target | CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. |
| Uniprot ID | Q9HCS2 |
| Protein Accession # | NP_076433 |
| Nucleotide Accession # | NM_023944 |
| Protein Size (# AA) | 524 |
| Molecular Weight | 60kDa |
| Protein Interactions | SOD2; HSPA6; UBC; |