CYP2U1 Antibody - middle region - FITC
Referencia ARP61922_P050-FITC
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
CYP2U1 Antibody - middle region : FITC (ARP61922_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-CYP2U1 (ARP61922_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Goat: 79%; Horse: 79%; Human: 100%; Mouse: 77%; Pig: 79%; Rabbit: 100%; Rat: 79%; Sheep: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: VNICPWLYYLPFGPFKELRQIEKDITSFLKKIIKDHQESLDRENPQDFID |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CYP2U1 (ARP61922_P050-FITC) antibody is Catalog # AAP61922 (Previous Catalog # AAPP48165) |
| Gene Symbol | CYP2U1 |
|---|---|
| Gene Full Name | Cytochrome P450, family 2, subfamily U, polypeptide 1 |
| Alias Symbols | SPG49, SPG56, P450TEC |
| NCBI Gene Id | 113612 |
| Protein Name | Cytochrome P450 2U1 |
| Description of Target | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is a hydroxylase that metabolizes arachidonic acid, docosahexaenoic acid, and other long chain fatty acids. |
| Uniprot ID | Q7Z449 |
| Protein Accession # | NP_898898 |
| Nucleotide Accession # | NM_183075 |
| Protein Size (# AA) | 544 |
| Molecular Weight | 60kDa |