Quimigen Portugal > Cortactin (CTTN) (NM_138565) Human Recombinant Protein
Cortactin (CTTN) (NM_138565) Human Recombinant Protein
Referencia TP301111
embalaje : 20ug
Contact local distributor :
Teléfono :
Cortactin (CTTN) (NM_138565) Human Recombinant Protein
-
MVProFull-length human proteins expressed in HEK293T cells
Be the first to review this product
SKU
TP301111
Recombinant protein of human cortactin (CTTN), transcript variant 2, 20 µg
Other products for "Cortactin or NM_138565"
| Product Data | |
| Species | Human |
|---|---|
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | >RC201111 protein sequence Red=Cloning site Green=Tags(s) MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRENVFQEHQTLK EKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRGFGGKFGVQMDRVDQSAVGFE YQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQGKTEKHESQRDYSKGFGGKYGIDKDKVDKSA VGFEYQGKTEKHESQKDYVKGFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRM DKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEA RRKLEEQARAKTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDD GWWRGVCKGRYGLFPANYVELRQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Bioactivity | ELISA capture for autoantibodies (PMID: 27379450) ELISA capture for autoantibodies (PMID: 29068555) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Shipping | Dry Ice |
| Reference Data | |
| RefSeq | NP_612632 |
| Locus ID | 2017 |
| UniProt ID | Q14247 |
| Cytogenetics | 11q13.3 |
| RefSeq Size | 3208 |
| RefSeq ORF | 1539 |
| Synonyms | EMS1 |
| Summary | This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene. provided by RefSeq, May 2010 |
| Protein Categories | Intracellular Proteins |
| Protein Families | Druggable Genome |
| Protein Pathways | Pathogenic Escherichia coli infection, Tight junction |
| FAQs |
|
| SDS |
| Recombinant Protein Resources |
| SKU | Description | Size | ||
|---|---|---|---|---|
| PH301111 | CTTN MS Standard C13 and N15-labeled recombinant protein (NP_612632) | 10 ug | | |
| LC403359 | Lyophilized CTTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC417430 | Lyophilized CTTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LC429248 | Lyophilized CTTN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug | | |
| LY403359 | Transient overexpression lysate of cortactin (CTTN), transcript variant 2 (as WB positive control) | 100 ug | | |
| LY417430 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 (as WB positive control) | 100 ug | | |
| LY429248 | Transient overexpression lysate of cortactin (CTTN), transcript variant 1 (as WB positive control) | 100 ug | | |
| TP710315 | Purified recombinant protein of Human cortactin (CTTN / EMS1), transcript variant 2, full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug | | |
Citations
Assessment of the breadth of binding promiscuity of heme towards human proteins
Roumenina, Dimitrov
Biol Chem (2022)
Roumenina, Dimitrov
Biol Chem (2022)
Cited by 17
AI Summary: OriGene contributed to this study by providing the human recombinant cortactin protein (OriGene, NM_138565), which was used to assess heme-protein interactions via surface plasmon resonance.
Snippet: The interaction of heme with a selected protein was performed by surface plasmon resonance-based technology (Cytiva Life Sciences, Biacore, Uppsala, Sweden). Human recombinant cortactin (Origene, NM_138565, MD, Maryland, USA) was covalently immobilized at the surface of CM5 sensor chip
Diagnostic utility of cortactin antibodies in myasthenia gravis
Illa, Cortés-Vicente, Martínez et al
Ann. N. Y. Acad. Sci. (2017)
Illa, Cortés-Vicente, Martínez et al
Ann. N. Y. Acad. Sci. (2017)
Cited by 47
AI Summary: OriGene’s purified recombinant cortactin protein was used to coat ELISA plates, enabling the detection of anti-cortactin antibodies in patient sera and supporting the identification of cortactin as a novel biomarker in myasthenia gravis.
Snippet: Hospital de la Santa Creu i Sant Pau. For the study of anti-cortactin antibodies, we designed an in-house enzyme-linked immunosorbent assay (ELISA) with plates containing purified recombinant cortactin (OriGene, Rockville, MD)
Clinical Characteristics of Patients With Double-Seronegative Myasthenia Gravis and Antibodies to Cortactin
Cortés-Vicente, Gallardo, Martínez et al
JAMA Neurol (2016)
Cortés-Vicente, Gallardo, Martínez et al
JAMA Neurol (2016)
Cited by 112
AI Summary: In this study, OriGene’s purified recombinant cortactin protein was used in Western blot assays to confirm the presence of cortactin antibodies in patient samples, enabling identification of a subgroup of double-seronegative myasthenia gravis patients with these antibodies.
Snippet: Cortac- tin antibodies were measured using the in-house enzyme- linked immunosorbent assay, and the results were confirmed by Western blot using a purified recombinant protein cortac- tin (OriGene) as previously described.19 A positive control and a ... Cited by 1 Cite SaveSaving
Cortactin autoantibodies in myasthenia gravis
Gallardo, Martínez-Hernández, Titulaer et al
Autoimmun Rev (2014)
Gallardo, Martínez-Hernández, Titulaer et al
Autoimmun Rev (2014)
Cited by 112
AI Summary: OriGene’s purified recombinant cortactin protein was used to coat ELISA plates, enabling the detection of cortactin autoantibodies in patient sera for this study on myasthenia gravis.
Snippet: Briefly, 96-well ELISA plates (NUNC, Kamstrup,Denmark) were coated with 100 ng/well of purified recombinant cortactin (OriGene, Rockville, Maryland,USA) diluted in phosphate-buffered saline (PBS) and left to stand overnight at 4 °C. Wells were incubated for ... Cited by 1 Cite SaveSaving
Identification of a novel myositis-associated antibody directed against cortactin
Labrador-Horrillo, Martínez
Autoimmunity Reviews (2014)
Labrador-Horrillo, Martínez
Autoimmunity Reviews (2014)
Cited by 1
AI Summary: In this study, OriGene's purified recombinant CTTN protein was used as the antigen in ELISA assays to help identify a novel myositis-associated antibody directed against cortactin.
Snippet: Briefly, 96-well ELISA plates (Costar, Corning, New York) were coated with 2 μg/mL of purified recombinant CTTN (OriGene, Rockville, MD) diluted in phosphate buffered saline (PBS) and left to stand overnight at 4 °C. Wells were incubated for 1 h at room temperature ... Cited by 1 Cite SaveSaving
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Related Products
Usted podría estar interesado también en los siguientes productos:
Referencia
Descripción
Cond.
Precio Sin IVA