CDX2 Antibody - middle region - HRP
Referencia ARP31476_P050-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
CDX2 Antibody - middle region : HRP (ARP31476_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-CDX2 (ARP31476_P050-HRP) antibody |
|---|
| Publications | Tajbakhsh, J. Covisualization of methylcytosine, global DNA, and protein biomarkers for In Situ 3D DNA methylation phenotyping of stem cells. Methods Mol. Biol. 1052, 77-88 (2013). ICC/IF, Pig, Dog, Bovine, Rabbit, Rat, Guinea pig, Mouse, Human, Horse 23593143 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDX2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 91%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CDX2 (ARP31476_P050-HRP) antibody is Catalog # AAP31476 (Previous Catalog # AAPP02238) |
| Reference | Saad,R.S., et al., (2004) J. Clin. Pathol. 122 (3), 421-427 |
|---|---|
| Gene Symbol | CDX2 |
| Gene Full Name | Caudal type homeobox 2 |
| Alias Symbols | CDX3, CDX-3, CDX2/AS |
| NCBI Gene Id | 1045 |
| Protein Name | Homeobox protein CDX-2 |
| Description of Target | CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus. |
| Uniprot ID | Q99626 |
| Protein Accession # | NP_001256 |
| Nucleotide Accession # | NM_001265 |
| Protein Size (# AA) | 313 |
| Molecular Weight | 34kDa |
| Protein Interactions | CDK2; SMARCD1; SMARCB1; SMARCA4; SMARCA2; KDM5B; UBB; PAX6; GSK3B; EP300; CDX2; MAPK14; CREBBP; MAPK1; HNF1A; ACAT2; |
