CDTC Protein, E. coli, Recombinant (His & Myc)
Referencia NB-64-49284-200ug
embalaje : 200ug
Marca : Neo Biotech
Remove All
CDTC Protein, E. coli, Recombinant (His & Myc)
(Synonyms: Cytolethal distending toxin subunit C, cdtC, CDT C) Copy Product InfoSynonyms: Cytolethal distending toxin subunit C, cdtC, CDT C
Catalog No. TMPH-00606 Copy Product Info
Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB. CDTC Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 25.7 kDa and the accession number is Q46670.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB. CDTC Protein, E. coli, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 25.7 kDa and the accession number is Q46670. |
| Species | E. coli |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | Q46670 |
| Amino Acid | CSSSQDSANNQIDELGKENNSLFTFRNIQSGLMIHNGLHQHGRETIGWEIVPVKTPEEALVTDQSGWIMIRTPNTDQCLGTPDGRNLLKMTCNSTAKKTLFSLIPSTTGAVQIKSVLSGLCFLDSKNSGLSFETGKCIADFKKPFEVVPQSHLWMLNPLNTESPII |
| Construction | 16-181 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Cytolethal distending toxin subunit C, cdtC, CDT C |
| Research Background | Part of the tripartite complex that is required for the CDT activity. CdtC, along with CdtA, probably forms a heterodimeric subunit required for the delivery of CdtB. |
| Molecular Weight | 25.7 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
CDT-C
Related Tags: CDTC Protein, E. coli, Recombinant (His & Myc) chemical structure | CDTC Protein, E. coli, Recombinant (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

