- Specifications
Product Description
Mouse polyclonal antibody raised against a partial recombinant CDH17.
Immunogen
CDH17 (NP_004054, 24 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
Sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (83)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.99 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
ELISA
Western Blot (Recombinant protein)
- Gene Info — CDH17
Entrez GeneID
1015GeneBank Accession#
NM_004063Protein Accession#
NP_004054Gene Name
CDH17
Gene Alias
CDH16, FLJ26931, HPT-1, HPT1, MGC138218, MGC142024
Gene Description
cadherin 17, LI cadherin (liver-intestine)
Omim ID
603017Gene Ontology
HyperlinkGene Summary
This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
HPT-1 cadherin|LI cadherin|cadherin 17|cadherin-16|human intestinal peptide-associated transporter HPT-1|human peptide transporter 1|liver-intestine cadherin
- Interactomes
- Diseases
CDH17 polyclonal antibody (A01)
Referencia H00001015-A01
embalaje : 50uL
Marca : Abnova
Images


