Candidapepsin-2 Protein, Candida albicans, Recombinant (His)
Referencia NB-64-49011-100ug
embalaje : 100ug
Marca : Neo Biotech
Remove All
Candidapepsin-2 Protein, Candida albicans, Recombinant (His)
(Synonyms: Secreted aspartic protease 2, SAP2, PRA11, Pepsinogen-11, PEP11, Candidapepsin-2, Aspartate protease 2, ACP 2) Copy Product InfoSynonyms: Secreted aspartic protease 2, SAP2, PRA11, Pepsinogen-11, PEP11, Candidapepsin-2, Aspartate protease 2, ACP 2
Catalog No. TMPH-00333 Copy Product Info
Candidapepsin-2 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 42.4 kDa and the accession number is P0CS83.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Candidapepsin-2 Protein, Candida albicans, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 42.4 kDa and the accession number is P0CS83. |
| Species | Candida albicans |
| Expression System | E. coli |
| Tag | N-10xHis |
| Accession Number | P0CS83 |
| Amino Acid | QAVPVTLHNEQVTYAADITVGSNNQKLNVIVDTGSSDLWVPDVNVDCQVTYSDQTADFCKQKGTYDPSGSSASQDLNTPFKIGYGDGSSSQGTLYKDTVGFGGVSIKNQVLADVDSTSIDQGILGVGYKTNEAGGSYDNVPVTLKKQGVIAKNAYSLYLNSPDAATGQIIFGGVDNAKYSGSLIALPVTSDRELRISLGSVEVSGKTINTDNVDVLLDSGTTITYLQQDLADQIIKAFNGKLTQDSNGNSFYEVDCNLSGDVVFNFSKNAKISVPASEFAASLQGDDGQPYDKCQLLFDVNDANILGDNFLRSAYIVYDLDDNEISLAQVKYTSASSISALT |
| Construction | 57-398 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Secreted aspartic protease 2, SAP2, PRA11, Pepsinogen-11, PEP11, Candidapepsin-2, Aspartate protease 2, ACP 2 |
| Molecular Weight | 42.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
SAP 2PRA 11Pepsinogen11PEP 11Candidapepsin2Aspartate protease2ACP2
Related Tags: Candidapepsin-2 Protein, Candida albicans, Recombinant (His) chemical structure | Candidapepsin-2 Protein, Candida albicans, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

