BMI1, N-His, recombinant protein

Referencia NB-21-25656

embalaje : 100ug

Marca : Neo Biotech

Contact local distributor :


Teléfono : +1 850 650 7790

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P35226
Molecular weight:
18.11 kDa
His Glu152–Ile289

Specifications BMI1, N-His, recombinant protein

Product name BMI1, N-His, recombinant protein
Uniprot ID P35226
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence EKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHI
Molecular weight 18.11 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Glu152-Ile289
Protein Accession P35226
Reference PX-P5518
Note For research use only
Molecular Constructor
His Glu152–Ile289

Documents

3D Representation

BMI1, N-His, recombinant protein

Reviews

There are no reviews yet.

Be the first to review “BMI1, N-His, recombinant protein” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody