ARF1 Antibody - middle region - Biotin
Referencia ARP48183_P050-Biotin
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ARF1 Antibody - middle region : Biotin (ARP48183_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-ARF1 (ARP48183_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 93%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ARF1 (ARP48183_P050-Biotin) antibody is Catalog # AAP48183 (Previous Catalog # AAPP28692) |
| Gene Symbol | ARF1 |
|---|---|
| Gene Full Name | ADP-ribosylation factor 1 |
| Alias Symbols | PVNH8 |
| NCBI Gene Id | 375 |
| Protein Name | ADP-ribosylation factor 1 |
| Description of Target | ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. |
| Uniprot ID | P84077 |
| Protein Accession # | NP_001649 |
| Nucleotide Accession # | NM_001658 |
| Protein Size (# AA) | 181 |
| Molecular Weight | 21kDa |
| Protein Interactions | GGA1; GGA3; GGA2; HUWE1; UBC; FBXO6; MMS19; TMEM106A; VCAM1; ITGA4; ATF2; ARF3; UBD; GRK5; CDK2; HERC1; Proser1; AI837181; Kif1c; Bach1; nef; COPB1; GEA1; WBP11; TMED2; PICK1; NOA1; TMED10; EEF1G; PLEKHA8; COPG1; ARFIP1; ARFIP2; ARHGAP21; ARFGAP1; AP3D1; |
