Ap4s1 Antibody - N-terminal region
Referencia ARP52283_P050
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Ap4s1 Antibody - N-terminal region (ARP52283_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-Ap4s1 (ARP52283_P050) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ap4s1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: KFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Ap4s1 (ARP52283_P050) antibody is Catalog # AAP52283 |
| Subunit | sigma-1 |
| Gene Symbol | Ap4s1 |
|---|---|
| Gene Full Name | adaptor-related protein complex 4, sigma 1 subunit |
| Alias Symbols | AI314282 |
| NCBI Gene Id | 11782 |
| Protein Name | AP-4 complex subunit sigma-1 |
| Description of Target | Ap4s1 is a subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system. |
| Uniprot ID | Q9WVL1 |
| Protein Accession # | NP_068356 |
| Nucleotide Accession # | NM_021710 |
| Protein Size (# AA) | 144 |
| Molecular Weight | 16kDa |
