AP3S1 Antibody - N-terminal region - Biotin

Referencia ARP51935_P050-Biotin

embalaje : 100ul

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

AP3S1 Antibody - N-terminal region : Biotin (ARP51935_P050-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-AP3S1 (ARP51935_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AP3S1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE
Concentration0.5 mg/ml
Blocking PeptideFor anti-AP3S1 (ARP51935_P050-Biotin) antibody is Catalog # AAP51935 (Previous Catalog # AAPY03591)
Subunitsigma-1
ReferenceLefrancois,S., (2004) Dev. Cell 7 (4), 619-625
Gene SymbolAP3S1
Gene Full NameAdaptor-related protein complex 3, sigma 1 subunit
Alias SymbolsCLAPS3, Sigma3A
NCBI Gene Id1176
Protein NameAP-3 complex subunit sigma-1
Description of TargetAP3S1 is part of the AP-3 complex, an adapter-related complex which is not clathrin-associated. The complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes.
Uniprot IDQ92572
Protein Accession #NP_001275
Nucleotide Accession #NM_001284
Protein Size (# AA)193
Molecular Weight22kDa
Protein InteractionsUBC; STAU1; EGFR; RABL6; AP3M1; SSSCA1; SMC4; AP3D1; AP3B1; KRT7; FLNC; ECT2; ELAVL1; SLC30A3; AP3S2; SCARB2; AP3B2; IRS1;