ANXA4 Antibody - N-terminal region - HRP
Referencia ARP36686_T100-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ANXA4 Antibody - N-terminal region : HRP (ARP36686_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ANXA4 (ARP36686_T100-HRP) antibody |
|---|
| Publications | de la Cuesta, F. et al. A proteomic focus on the alterations occurring at the human atherosclerotic coronary intima. Mol. Cell. Proteomics 10, M110.003517 (2011). WB, IHC, Human, Pig, Dog, Rabbit, Rat, Bovine, Mouse, Horse, Guinea pig, Zebrafish 21248247 Staquicini, F. I. et al. Vascular ligand-receptor mapping by direct combinatorial selection in cancer patients. Proc. Natl. Acad. Sci. U. S. A. 108, 18637-42 (2011). WB, IHC, Human, Pig, Dog, Rabbit, Rat, Bovine, Mouse, Horse, Guinea pig, Zebrafish 22049339 |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA4 |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANXA4 (ARP36686_T100-HRP) antibody is Catalog # AAP36686 (Previous Catalog # AAPP08113) |
| Reference | Zimmermann,U., et al., (2004) Cancer Lett. 209 (1), 111-118 |
|---|---|
| Gene Symbol | ANXA4 |
| Gene Full Name | Annexin A4 |
| Alias Symbols | ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274 |
| NCBI Gene Id | 307 |
| Protein Name | Annexin RuleBase RU003540 |
| Description of Target | Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells. |
| Uniprot ID | Q6LES2 |
| Protein Accession # | NP_001144 |
| Nucleotide Accession # | NM_001153 |
| Protein Size (# AA) | 321 |
| Molecular Weight | 35kDa |
| Protein Interactions | PADI4; UBC; EZH2; DNAJB11; MPST; ANXA7; ANXA3; ANXA1; TINF2; POT1; SUMO2; NMT2; SMPD1; Cdk1; UCHL5; H2AFX; NFKB1; GP2; |
