ANXA2 Antibody - C-terminal region - HRP
Referencia ARP36588_T100-HRP
embalaje : 100ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
ANXA2 Antibody - C-terminal region : HRP (ARP36588_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-ANXA2 (ARP36588_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANXA2 (ARP36588_T100-HRP) antibody is Catalog # AAP36588 (Previous Catalog # AAPP07821) |
| Reference | Katsunuma,T., et al., (2004) Int. Arch. Allergy Immunol. 134 (1), 29-33 |
|---|---|
| Gene Symbol | ANXA2 |
| Gene Full Name | Annexin A2 |
| Alias Symbols | P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270 |
| NCBI Gene Id | 302 |
| Protein Name | Annexin A2 |
| Description of Target | ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2. |
| Uniprot ID | Q8TBV2 |
| Protein Accession # | NP_004030 |
| Nucleotide Accession # | NM_004039 |
| Protein Size (# AA) | 339 |
| Molecular Weight | 37kDa |
| Protein Interactions | ISG15; UBC; S100A10; PLA2G4A; SPRTN; SUMO2; SUMO3; MDM2; NEDD8; RPA3; RPA2; RPA1; ASB9; WWOX; LOC100128588; DNAJC8; PARK2; YWHAQ; ATP4A; BAG3; TERT; TP53; NPM1; HMGA1; MYC; MLH1; ITGA4; FN1; ESR1; GRDX; IQCB1; VCAM1; VCP; HNF1A; RPS13; RPL11; APP; GNB2L1; |
