Ankrd37 Antibody - N-terminal region
Referencia ARP55803_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
Ankrd37 Antibody - N-terminal region (ARP55803_P050)
| Datasheets/Manuals | Printable datasheet for anti-Ankrd37 (ARP55803_P050) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Ankrd37 (ARP55803_P050) antibody is Catalog # AAP55803 |
| Gene Symbol | Ankrd37 |
|---|---|
| Gene Full Name | Ankyrin repeat domain 37 |
| Alias Symbols | - |
| NCBI Gene Id | 654824 |
| Protein Name | Ankyrin repeat domain-containing protein 37 |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | Q569N2 |
| Protein Accession # | NP_001034651 |
| Nucleotide Accession # | NM_001039562 |
| Protein Size (# AA) | 159 |
| Molecular Weight | 17kDa |
| Protein Interactions | Ubc; Fem1b; |
