AK5 Antibody - N-terminal region
Referencia ARP54829_P050-25UL
embalaje : 25ul
Marca : Aviva Systems Biology
Contact local distributor :
Teléfono : +1 850 650 7790
AK5 Antibody - N-terminal region (ARP54829_P050)
| Datasheets/Manuals | Printable datasheet for anti-AK5 (ARP54829_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AK5 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 91%; Yeast: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: ESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-AK5 (ARP54829_P050) antibody is Catalog # AAP54829 (Previous Catalog # AAPP31633) |
| Gene Symbol | AK5 |
|---|---|
| Gene Full Name | Adenylate kinase 5 |
| Alias Symbols | AK6 |
| NCBI Gene Id | 26289 |
| Protein Name | Adenylate kinase isoenzyme 5 |
| Description of Target | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
| Uniprot ID | Q9Y6K8 |
| Protein Accession # | NP_777283 |
| Nucleotide Accession # | NM_174858 |
| Protein Size (# AA) | 562 |
| Molecular Weight | 62kDa |
| Protein Interactions | CEBPA; STRN4; TRIM46; C7orf26; NUCKS1; RNF114; CPNE6; UGDH; |
