YARS Antibody - C-terminal region - FITC
Cat# ARP40471_T100-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
YARS Antibody - C-terminal region : FITC (ARP40471_T100-FITC)
| Datasheets/Manuals | Printable datasheet for anti-YARS (ARP40471_T100-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human YARS |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 91%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: QVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-YARS (ARP40471_T100-FITC) antibody is Catalog # AAP40471 (Previous Catalog # AAPP22239) |
| Sample Type Confirmation | YARS is supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Jordanova,A., (2006) Nat. Genet. 38 (2), 197-202 |
|---|---|
| Gene Symbol | YARS |
| Gene Full Name | Tyrosyl-tRNA synthetase |
| Alias Symbols | YRS, YTS, YARS, TYRRS, CMTDIC |
| NCBI Gene Id | 8565 |
| Protein Name | Tyrosine--tRNA ligase, cytoplasmic |
| Description of Target | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine. |
| Uniprot ID | P54577 |
| Protein Accession # | NP_003671 |
| Nucleotide Accession # | NM_003680 |
| Protein Size (# AA) | 528 |
| Molecular Weight | 58kDa |
| Protein Interactions | UBC; SARNP; NRD1; HSPA8; VCAM1; ITGA4; FN1; METTL16; XRCC5; DYNC1H1; CDK2; ELANE; EIF1B; SAP18; EIF6; ARF6; |
