Vaccinia virus OPG190 Protein (His)

Cat# NB-64-127667-10ug

Size : 10ug

Brand : Neo Biotech

Contact local distributor :


Phone : +1 850 650 7790

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Vaccinia virus OPG190 Protein (His) is expressed in in vitro E. coli expression system. The accession number is Q80KX4.
Species
Vaccinia virus
Expression System
in vitro E. coli expression system
TagN-10xHis
Accession NumberQ80KX4
Synonyms
Protein OPG190,Plaque-size/host range protein,B5R
Amino Acid
MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNKEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP
Construction
1-317 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight41.2 kDa (Predicted)
EndotoxinNot tested.
FormulationLyophilized from PBS, 0.05% Brij-78, 6% Trehalose, pH 7.4
Reconstitution
Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 9 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More