Tmem120a Antibody Middle region
Cat# ARP96061_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
TMEM120A Antibody - middle region (ARP96061_P050)
| Datasheets/Manuals | Printable datasheet for anti-TMEM120A (ARP96061_P050) antibody |
|---|
| Tested Species Reactivity | Rat |
|---|---|
| Predicted Species Reactivity | Rat |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of rat TMEM120A |
| Purification | Affinity purified |
| Peptide Sequence | Synthetic peptide located within the following region: NGLYLSLVLGNVNVTLLSKQAKFAYKDEYEKFKLYLTIILIVISFTCRFL |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TMEM120A (ARP96061_P050) antibody is Catalog # AAP96061 |
| Gene Symbol | TMEM120A |
|---|---|
| Gene Full Name | transmembrane protein 120A |
| Alias Symbols | Tmp, Tmpit, 2010310D06Rik |
| NCBI Gene Id | 215210 |
| Protein Name | transmembrane protein 120A |
| Description of Target | Necessary for efficient adipogenesis. |
| Uniprot ID | Q5HZE2 |
| Protein Accession # | NP_766129.1 |
| Nucleotide Accession # | NM_172541.2 |
| Protein Size (# AA) | 343 |
| Molecular Weight | 41 kDa |