TGFB1 recombinant protein

Specifications TGFB1 recombinant protein

Product name	PX-P5187-100
Uniprot ID	P01137
Uniprot link	https://www.uniprot.org/uniprot/P01137
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight	10.59 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Fragment Type	Gly316-Ser390
Protein Accession	P01137
Aliases /Synonyms	TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference	PX-P5187
Note	For research use only.
Molecular Constructor	His Gly316–Ser390

Product name	PX-P5187-1MG
Uniprot ID	P01137
Uniprot link	https://www.uniprot.org/uniprot/P01137
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight	10.59 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Fragment Type	Gly316-Ser390
Protein Accession	P01137
Aliases /Synonyms	TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference	PX-P5187
Note	For research use only.
Molecular Constructor	His Gly316–Ser390

Product name	PX-P5187-50
Uniprot ID	P01137
Uniprot link	https://www.uniprot.org/uniprot/P01137
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	GYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular weight	10.59 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% as determined by SDS-PAGE
Buffer	PBS, pH7.5
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Yeast
Fragment Type	Gly316-Ser390
Protein Accession	P01137
Aliases /Synonyms	TGF-beta-1, LAP, Transforming Growth Factor proteins beta-1 proprotein, TGFB
Reference	PX-P5187
Note	For research use only.
Molecular Constructor	His Gly316–Ser390

Documents

• Datasheet
• MSDS

QC & Validation

TGFB1 recombinant protein binds to Fresolimumab Biosimilar - Anti-TGFB, TGF beta mAb in indirect ELISA assay

Immobilized TGFB1 recombinant protein (cat. No.PX-P5187) at 0.5µg/mL (100µL/well) can bind Fresolimumab Biosimilar - Anti-TGFB, TGF beta mAb (cat. No.PX-TA1128) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 217.5M.

TGFB1 recombinant protein binds to Metelimumab Biosimilar - Anti-TGFB1 mAb in indirect ELISA assay

Immobilized TGFB1 recombinant protein (cat. No.PX-P5187) at 0.5µg/mL (100µL/well) can bind Metelimumab Biosimilar - Anti-TGFB1 mAb (cat. No.PX-TA1138) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 133.8M.

3D Representation

Reviews

There are no reviews yet.

Be the first to review “TGFB1 recombinant protein” Cancel reply