SUPT6H antibody - N-terminal region
Cat# ARP38260_T100
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
SUPT6H Antibody - N-terminal region (ARP38260_T100)
| Datasheets/Manuals | Printable datasheet for anti-SUPT6H (ARP38260_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT6H |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: EAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGF |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-SUPT6H (ARP38260_T100) antibody is Catalog # AAP38260 (Previous Catalog # AAPP20469) |
| Sample Type Confirmation | SUPT6H is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Endoh,M., et al., (2004) Mol. Cell. Biol. 24 (8), 3324-3336 |
|---|---|
| Gene Symbol | SUPT6H |
| Gene Full Name | Suppressor of Ty 6 homolog (S. cerevisiae) |
| Alias Symbols | SPT6, SPT6H, emb-5 |
| NCBI Gene Id | 6830 |
| Protein Name | Transcription elongation factor SPT6 |
| Description of Target | SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF). |
| Uniprot ID | Q7KZ85 |
| Protein Accession # | NP_003161 |
| Nucleotide Accession # | NM_003170 |
| Protein Size (# AA) | 1726 |
| Molecular Weight | 199kDa |
| Protein Interactions | CEP76; HAUS2; CEP250; TUBGCP3; CEP57; VCP; TUBG1; TP53; EMD; CDKN1A; UBC; EED; BMI1; POLR2C; ERBB2; CSNK2A1; BRCA1; MDC1; PAAF1; SIRT7; SUMO2; POLR2A; IWS1; WDR48; TCEA1; |
