SLC26A3 Antibody - middle region - Biotin
Cat# ARP31608_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
SLC26A3 Antibody - middle region : Biotin (ARP31608_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-SLC26A3 (ARP31608_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB, IHC |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC26A3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 79%; Guinea Pig: 79%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SLC26A3 (ARP31608_P050-Biotin) antibody is Catalog # AAP31608 (Previous Catalog # AAPP02389) |
| Sample Type Confirmation | SLC26A3 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Dorwart,M.R., (2008) J. Biol. Chem. 283 (13), 8711-8722 |
|---|---|
| Gene Symbol | SLC26A3 |
| Gene Full Name | Solute carrier family 26, member 3 |
| Alias Symbols | CLD, DRA |
| NCBI Gene Id | 1811 |
| Protein Name | Chloride anion exchanger |
| Description of Target | SLC26A3 is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P40879 |
| Protein Accession # | NP_000102 |
| Nucleotide Accession # | NM_000111 |
| Protein Size (# AA) | 764 |
| Molecular Weight | 84kDa |
| Protein Interactions | SLC9A3R1; SLC9A3R2; |
