SLC25A25 Antibody - N-terminal region

Cat# ARP43761_P050-25UL

Size : 25ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

SLC25A25 Antibody - N-terminal region (ARP43761_P050)

Datasheets/ManualsPrintable datasheet for anti-SLC25A25 (ARP43761_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC25A25
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AVGLRRLGLHRTEGELQKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLV
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC25A25 (ARP43761_P050) antibody is Catalog # AAP43761 (Previous Catalog # AAPP25351)
ReferenceFiermonte,G., (2004) J. Biol. Chem. 279 (29), 30722-30730
Gene SymbolSLC25A25
Gene Full NameSolute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25
Alias SymbolsMCSC, PCSCL, SCAMC-2
NCBI Gene Id114789
Protein NameCalcium-binding mitochondrial carrier protein SCaMC-2
Description of TargetThe function remains unknown.
Uniprot IDQ6KCM6
Protein Accession #NP_001006642
Nucleotide Accession #NM_001006641
Protein Size (# AA)503
Molecular Weight55kDa
Protein InteractionsUBC;

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
ARP35123_P050-25UL
 25ul 
ARP43818_P050-25UL
 25ul 
ARP35122_T100-25UL
 25ul