Recombinant horse Serum amyloid A protein
Cat# OPCA01299-20UG
Size : 20ug
Brand : Aviva Systems Biology
SAA1 Recombinant Protein (Horse) (OPCA01299)
Datasheets/Manuals | Printable datasheet for SAA1 Recombinant Protein (Horse) (OPCA01299) |
---|
Predicted Species Reactivity | Equus caballus|Horse |
---|---|
Product Format | Liquid or Lyophilized powder |
Reconstitution and Storage | -20°C or -80°C |
Peptide Sequence | LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY |
Source | Yeast |
Protein Name | Serum amyloid A protein |
---|---|
Description of Target | Major acute phase reactant. Apolipoprotein of the HDL complex. |
Uniprot ID | P19857 |
Protein Size (# AA) | Full Length |
Molecular Weight | 14.3 kDa |