RAE1 Antibody - C-terminal region - Biotin
Cat# ARP40301_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
RAE1 Antibody - C-terminal region : Biotin (ARP40301_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-RAE1 (ARP40301_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RAE1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Peptide Sequence | Synthetic peptide located within the following region: EQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-RAE1 (ARP40301_P050-Biotin) antibody is Catalog # AAP40301 (Previous Catalog # AAPP10338) |
| Sample Type Confirmation | RAE1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat |
| Reference | Blower,M.D., (2005) Cell 121 (2), 223-234 |
|---|---|
| Gene Symbol | RAE1 |
| Gene Full Name | RAE1 RNA export 1 homolog (S. pombe) |
| Alias Symbols | Gle2, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1 |
| NCBI Gene Id | 8480 |
| Protein Name | mRNA export factor |
| Description of Target | RAE1 is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.Mutations in the Schizosaccharomyces pombe Rae1 and Saccharomyces cerevisiae Gle2 genes have been shown to result in accumulation of poly(A)-containing mRNA in the nucleus, suggesting that the encoded proteins are involved in RNA export. The protein encoded by this gene is a homolog of yeast Rae1. It contains four WD40 motifs, and has been shown to localize to distinct foci in the nucleoplasm, to the nuclear rim, and to meshwork-like structures throughout the cytoplasm. This gene is thought to be involved in nucleocytoplasmic transport, and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton. Alternatively spliced transcript variants encoding the same protein have been found for this gene. |
| Uniprot ID | P78406 |
| Protein Accession # | NP_001015885 |
| Nucleotide Accession # | NM_001015885 |
| Protein Size (# AA) | 368 |
| Molecular Weight | 40kDa |
| Protein Interactions | TP53; CDC37; DGCR8; YAP1; STK3; EEF2K; SOX2; HNRNPUL1; YWHAQ; UBC; FN1; ZC3HAV1; UBD; DDX39B; NUP98; MAP2; NUMA1; RNA28S5; RNA18S5; LSM14A; IGF2BP3; NXF1; TACC3; DYNLL1; KHSRP; KPNB1; ILF3; COPS6; CUL1; CUL3; Nup214; Nup188; KAT2A; PTTG1; POLR3H; FAM122B; |
