QPCT Antibody - middle region - FITC
Cat# ARP48743_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
QPCT Antibody - middle region : FITC (ARP48743_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-QPCT (ARP48743_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human QPCT |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 100%; Sheep: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: SRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSA |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-QPCT (ARP48743_P050-FITC) antibody is Catalog # AAP48743 (Previous Catalog # AAPP28792) |
| Reference | Cynis,H., (2008) J. Mol. Biol. 379 (5), 966-980 |
|---|---|
| Gene Symbol | QPCT |
| Gene Full Name | Glutaminyl-peptide cyclotransferase |
| Alias Symbols | QC, GCT, sQC |
| NCBI Gene Id | 25797 |
| Protein Name | Glutaminyl-peptide cyclotransferase |
| Description of Target | QPCT is responsible for the biosynthesis of pyroglutamyl peptides. QPCT has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. It also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. QPCT may be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.This gene encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q16769 |
| Protein Accession # | NP_036545 |
| Nucleotide Accession # | NM_012413 |
| Protein Size (# AA) | 361 |
| Molecular Weight | 38kDa |
| Protein Interactions | CAND1; DCUN1D1; COPS5; CUL1; CUL2; CUL3; CUL4A; CUL4B; CUL5; NEDD8; UBC; |
