PQLC1 antibody - middle region
Cat# ARP49922_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PQLC1 Antibody - middle region (ARP49922_P050)
| Datasheets/Manuals | Printable datasheet for anti-PQLC1 (ARP49922_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PQLC1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: TYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PQLC1 (ARP49922_P050) antibody is Catalog # AAP49922 (Previous Catalog # AAPY02765) |
| Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
|---|---|
| Gene Symbol | PQLC1 |
| Gene Full Name | PQ loop repeat containing 1 |
| Alias Symbols | PQLC1 |
| NCBI Gene Id | 80148 |
| Protein Name | PQ-loop repeat-containing protein 1 |
| Description of Target | PQLC1 is a multi-pass membrane protein. It contains 2 PQ-loop domains. The exact function of PQLC1 remains unknown. |
| Uniprot ID | Q8N2U9 |
| Protein Accession # | NP_079354 |
| Nucleotide Accession # | NM_025078 |
| Protein Size (# AA) | 271 |
| Molecular Weight | 30kDa |
| Protein Interactions | ADH5; UBC; |