PIEZO2 Antibody - N-terminal region
Cat# ARP49682_P050
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PIEZO2 Antibody - N-terminal region (ARP49682_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-PIEZO2 (ARP49682_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PIEZO2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: VFGFWAFGKHSAAADITSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PIEZO2 (ARP49682_P050) antibody is Catalog # AAP49682 |
| Enhanced Validation | SPR Affinity Characterization  |
| Gene Symbol | PIEZO2 |
|---|---|
| Gene Full Name | piezo-type mechanosensitive ion channel component 2 |
| Alias Symbols | DA3, DA5, MWKS, DAIPT, FAM38B, HsT748, HsT771, FAM38B2, C18orf30, C18orf58 |
| NCBI Gene Id | 63895 |
| Protein Name | Piezo-type mechanosensitive ion channel component 2 |
| Description of Target | Piezos are large transmembrane proteins conserved among various species, all having between 24 and 36 predicted transmembrane domains. 'Piezo' comes from the Greek 'piesi,' meaning 'pressure.' The PIEZO2 protein has a role in rapidly adapting mechanically activated (MA) currents in somatosensory neurons. |
| Uniprot ID | Q9H5I5-3 |
| Protein Size (# AA) | 709 |
| Molecular Weight | 77 kDa |
| Protein Interactions | UBC; |
