PAK6 Antibody - C-terminal region - Biotin
Cat# ARP32119_P050-Biotin
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PAK6 Antibody - C-terminal region : Biotin (ARP32119_P050-Biotin)
| Datasheets/Manuals | Printable datasheet for anti-PAK6 (ARP32119_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PAK6 |
| Purification | Affinity purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: LRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTST |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PAK6 (ARP32119_P050-Biotin) antibody is Catalog # AAP32119 |
| Reference | N/A |
|---|---|
| Gene Symbol | PAK6 |
| Gene Full Name | p21 protein (Cdc42/Rac)-activated kinase 6 |
| Alias Symbols | PAK5 |
| NCBI Gene Id | 56924 |
| Protein Name | Serine/threonine-protein kinase PAK 6 |
| Description of Target | This gene encodes a member of a family of p21-stimulated serine/threonine protein kinases, which contain an amino-terminal Cdc42/Rac interactive binding (CRIB) domain and a carboxyl-terminal kinase domain. These kinases function in a number of cellular processes, including cytoskeleton rearrangement, apoptosis, and the mitogen-activated protein (MAP) kinase signaling pathway. The protein encoded by this gene interacts with androgen receptor (AR) and translocates to the nucleus, where it is involved in transcriptional regulation. Changes in expression of this gene have been linked to prostate cancer. Alternative splicing results in multiple transcript variants. |
| Uniprot ID | Q9NQU5 |
| Protein Accession # | NP_064553 |
| Protein Size (# AA) | 681 |
| Molecular Weight | 74kDa |
| Protein Interactions | RHOJ; RAC1; NEK6; SEMA3B; TPD52L1; SNX2; HSP90AA1; CDK1; MDM2; AR; APP; LNX1; MYC; MAPK14; CDC42; ESR1; AKT1; YWHAQ; |
