PAIP1 Antibody - C-terminal region - HRP
Cat# ARP40651_T100-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
PAIP1 Antibody - C-terminal region : HRP (ARP40651_T100-HRP)
| Datasheets/Manuals | Printable datasheet for anti-PAIP1 (ARP40651_T100-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PAIP1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-PAIP1 (ARP40651_T100-HRP) antibody is Catalog # AAP40651 (Previous Catalog # AAPP10626) |
| Sample Type Confirmation | There is BioGPS gene expression data showing that PAIP1 is expressed in HepG2 |
| Reference | Roy,G., (2002) Mol. Cell. Biol. 22 (11), 3769-3782 |
|---|---|
| Gene Symbol | PAIP1 |
| Gene Full Name | Poly(A) binding protein interacting protein 1 |
| NCBI Gene Id | 10605 |
| Protein Name | Polyadenylate-binding protein-interacting protein 1 |
| Description of Target | PAIP1 interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation.The protein encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. |
| Uniprot ID | Q9H074-2 |
| Protein Accession # | NP_877590 |
| Nucleotide Accession # | NM_182789 |
| Protein Size (# AA) | 400 |
| Molecular Weight | 44kDa |
| Protein Interactions | PABPC1; WWP2; UBC; BMI1; PDCD4; ADSL; CBX6; UPF2; NUBP2; CAND1; UBR5; CUL3; SYNCRIP; CSDE1; HNRNPD; USP12; EIF4A1; |
