- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant NRP1.
Immunogen
NRP1 (NP_003864, 22 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NRP1 is approximately 0.03ng/ml as a capture antibody.Immunoprecipitation
Immunoprecipitation of NRP1 transfected lysate using anti-NRP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NRP1 MaxPab rabbit polyclonal antibody.Western Blot (Cell lysate)
NRP1 monoclonal antibody (M05), clone 1B3 Western Blot analysis of NRP1 expression in HeLa ( Cat # L013V1 ).Western Blot (Transfected lysate)
Western Blot analysis of NRP1 expression in transfected 293T cell line by NRP1 monoclonal antibody (M05), clone 1B3.
Lane 1: NRP1 transfected lysate(68.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
- Gene Info — NRP1
Entrez GeneID
8829GeneBank Accession#
NM_003873Protein Accession#
NP_003864Gene Name
NRP1
Gene Alias
BDCA4, CD304, DKFZp686A03134, DKFZp781F1414, NP1, NRP, VEGF165R
Gene Description
neuropilin 1
Omim ID
602069Gene Ontology
HyperlinkGene Summary
NRP1 is a membrane-bound coreceptor to a tyrosine kinase receptor for both vascular endothelial growth factor (VEGF; MIM 192240) and semaphorin (see SEMA3A; MIM 603961) family members. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.[supplied by OMIM
Other Designations
OTTHUMP00000020818|OTTHUMP00000020820|OTTHUMP00000020821|neuropilin-1|transmembrane receptor
- Interactomes
- Pathways
- Diseases
- Publication Reference
- Adjuvant effects of formalin-inactivated HSV through activation of dendritic cells and inactivation of myeloid-derived suppressor cells in cancer immunotherapy.
Ohkusu-Tsukada K, Ohta S, Kawakami Y, Toda M.
International Journal of Cancer 2011 Jan; 128(1):119.
Application:WB, Mouse, Mouse B cells.
- EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERS.
George G. Klee, George Vasmatzis, Farhad Kosari, Eric W. Klee
United States Patent Application Publication 2010 Feb; [Epub].
Application:Array, Mammal, Prostate cancer.
- Adjuvant effects of formalin-inactivated HSV through activation of dendritic cells and inactivation of myeloid-derived suppressor cells in cancer immunotherapy.
NRP1 monoclonal antibody (M05), clone 1B3
Cat# H00008829-M05
Size : 100ug
Brand : Abnova
Images






