MED16 Antibody - N-terminal region - HRP
Cat# ARP31452_P050-HRP
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
MED16 Antibody - N-terminal region : HRP (ARP31452_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-MED16 (ARP31452_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MED16 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: FGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MED16 (ARP31452_P050-HRP) antibody is Catalog # AAP31452 (Previous Catalog # AAPP03283) |
| Sample Type Confirmation | MED16 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
| Subunit | 16 |
| Reference | Sato,S., (2004) Mol. Cell 14 (5), 685-691 |
|---|---|
| Gene Symbol | MED16 |
| Gene Full Name | Mediator complex subunit 16 |
| Alias Symbols | DRIP92, THRAP5, TRAP95 |
| NCBI Gene Id | 10025 |
| Protein Name | Mediator of RNA polymerase II transcription subunit 16 |
| Description of Target | THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators. |
| Uniprot ID | Q9Y2X0 |
| Protein Accession # | NP_005472 |
| Nucleotide Accession # | NM_005481 |
| Protein Size (# AA) | 877 |
| Molecular Weight | 97kDa |
| Protein Interactions | HECW2; CDK19; CDK8; UBC; MED19; MED26; EPAS1; FBXW7; MED11; MED8; MED29; MED9; MED18; MED4; RALY; MED13; MED12; MED24; MED21; MED14; MED1; CTDP1; HIST1H3A; MED10; MED25; MED15; VDR; TRA; MED28; OBFC1; ZC3H13; QKI; TADA2A; SUPT7L; SUPT3H; MYC; KAT2A; TRRAP |
