MAPT Antibody - middle region - FITC
Cat# ARP48104_P050-FITC
Size : 100ul
Brand : Aviva Systems Biology
Contact local distributor :
Phone : +1 850 650 7790
MAPT Antibody - middle region : FITC (ARP48104_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-MAPT (ARP48104_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAPT |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MAPT (ARP48104_P050-FITC) antibody is Catalog # AAP48104 (Previous Catalog # AAPP28209) |
| Sample Type Confirmation | MAPT is strongly supported by BioGPS gene expression data to be expressed in NCI-H226 |
| Gene Symbol | MAPT |
|---|---|
| Gene Full Name | Microtubule-associated protein tau |
| Alias Symbols | TAU, MSTD, PPND, DDPAC, MAPTL, MTBT1, MTBT2, tau-40, FTDP-17, PPP1R103 |
| NCBI Gene Id | 4137 |
| Protein Name | Microtubule-associated protein tau |
| Description of Target | MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. |
| Uniprot ID | P10636-6 |
| Protein Accession # | NP_058518 |
| Nucleotide Accession # | NM_016834 |
| Protein Size (# AA) | 383 |
| Molecular Weight | 40kDa |
| Protein Interactions | Ywhaz; Prkaca; STUB1; PHGK; SRC; PRKAR1A; GSK3B; FYN; DCTN1; CSNK1A1; CDK2; AKT1; ABL1; YWHAQ; SGK1; MARK2; MARCH7; TUBB3; TUBA1B; UBC; TUBA4A; MARK4; PEG10; MARK3; MARK1; MAPK13; MAPK11; MAPK8; mapk14; Mapk12; LIMS1; HSPA1A; PPP5C; PPP2R4; CAPN2; PKN1; H |
